CIB3 polyclonal antibody
  • CIB3 polyclonal antibody

CIB3 polyclonal antibody

Ref: AB-PAB28132
CIB3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CIB3.
Información adicional
Size 100 uL
Gene Name CIB3
Gene Alias KIP3|MGC138405|MGC142151|MGC96922
Gene Description calcium and integrin binding family member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FNNDDYICAWDLEQTVTKLTRGGLSAEEVSLVCEKVLDEADG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant CIB3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 117286
Iso type IgG

Enviar uma mensagem


CIB3 polyclonal antibody

CIB3 polyclonal antibody