STRN4 polyclonal antibody
  • STRN4 polyclonal antibody

STRN4 polyclonal antibody

Ref: AB-PAB28128
STRN4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STRN4.
Información adicional
Size 100 uL
Gene Name STRN4
Gene Alias FLJ35594|ZIN|zinedin
Gene Description striatin, calmodulin binding protein 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LCTFPTASEHGVPTSVAFTSTEPAHIVASFRSGDTVLYDMEVGSALLTLESRGSSGPTQINQVVSHPNQPLTITAHDDRGIRFLD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant STRN4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29888
Iso type IgG

Enviar uma mensagem


STRN4 polyclonal antibody

STRN4 polyclonal antibody