ANKS4B polyclonal antibody
  • ANKS4B polyclonal antibody

ANKS4B polyclonal antibody

Ref: AB-PAB28127
ANKS4B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKS4B.
Información adicional
Size 100 uL
Gene Name ANKS4B
Gene Alias FLJ38819|HARP|MGC133380|MGC133381
Gene Description ankyrin repeat and sterile alpha motif domain containing 4B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VALLDKAATAQNIMNPKKVTRLKEQAQKNARRQIKECERLQEKHQNKMAHTYSKEESGTLSSSKGTFSRSSPSNASAP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant ANKS4B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 257629
Iso type IgG

Enviar uma mensagem


ANKS4B polyclonal antibody

ANKS4B polyclonal antibody