MRPL35 polyclonal antibody
  • MRPL35 polyclonal antibody

MRPL35 polyclonal antibody

Ref: AB-PAB28123
MRPL35 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MRPL35.
Información adicional
Size 100 uL
Gene Name MRPL35
Gene Alias L35mt|MRP-L35
Gene Description mitochondrial ribosomal protein L35
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCGHTSVILNRMAPVLPSVLKLPVRSLTYF
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant MRPL35.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51318
Iso type IgG

Enviar uma mensagem


MRPL35 polyclonal antibody

MRPL35 polyclonal antibody