C4orf19 polyclonal antibody
  • C4orf19 polyclonal antibody

C4orf19 polyclonal antibody

Ref: AB-PAB28120
C4orf19 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C4orf19.
Información adicional
Size 100 uL
Gene Name C4orf19
Gene Alias FLJ11017
Gene Description chromosome 4 open reading frame 19
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq VPSPGYVNEVNSCKLDEDDTDKLKGKWSSEVLVQKNDPQRQGSKKTESSSRTADPWEPCWPHQGPLPQGDAGGEHHACGVNGIGPAATPQPTGNSSPT
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant C4orf19.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55286
Iso type IgG

Enviar uma mensagem


C4orf19 polyclonal antibody

C4orf19 polyclonal antibody