CLIP4 polyclonal antibody
  • CLIP4 polyclonal antibody

CLIP4 polyclonal antibody

Ref: AB-PAB28113
CLIP4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLIP4.
Información adicional
Size 100 uL
Gene Name CLIP4
Gene Alias FLJ21069|FLJ32705|RSNL2
Gene Description CAP-GLY domain containing linker protein family, member 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq TIEDLPDFPLEGNPLFGRYPFIFSASDTPVIFSISAAPMPSDCEFSFFDPNDASCQEIL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant CLIP4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79745
Iso type IgG

Enviar uma mensagem


CLIP4 polyclonal antibody

CLIP4 polyclonal antibody