CCDC97 polyclonal antibody
  • CCDC97 polyclonal antibody

CCDC97 polyclonal antibody

Ref: AB-PAB28110
CCDC97 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC97.
Información adicional
Size 100 uL
Gene Name CCDC97
Gene Alias FLJ40267|MGC20255
Gene Description coiled-coil domain containing 97
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq PDKGCIEPGPGHWGELSRTPVPSKPQDKVEAAEATPVALDSDTSGAENAAVSAMLHAVAASRLPVCSQQQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant CCDC97.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90324
Iso type IgG

Enviar uma mensagem


CCDC97 polyclonal antibody

CCDC97 polyclonal antibody