THAP5 polyclonal antibody
  • THAP5 polyclonal antibody

THAP5 polyclonal antibody

Ref: AB-PAB28107
THAP5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant THAP5.
Información adicional
Size 100 uL
Gene Name THAP5
Gene Alias DKFZp313O1132
Gene Description THAP domain containing 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YLANPNFTSNSMEIKSAQENPFLFSTIKQTVEELNTNKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant THAP5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 168451
Iso type IgG

Enviar uma mensagem


THAP5 polyclonal antibody

THAP5 polyclonal antibody