ATPBD4 polyclonal antibody
  • ATPBD4 polyclonal antibody

ATPBD4 polyclonal antibody

Ref: AB-PAB28034
ATPBD4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATPBD4.
Información adicional
Size 100 uL
Gene Name ATPBD4
Gene Alias MGC14798
Gene Description ATP binding domain 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLYRRTIRGRSLDTRQVYTKCE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200 - 1:500)
Immunoflurorescence (1-4 µg/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATPBD4
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 89978
Iso type IgG

Enviar uma mensagem


ATPBD4 polyclonal antibody

ATPBD4 polyclonal antibody