OR10J3 polyclonal antibody
  • OR10J3 polyclonal antibody

OR10J3 polyclonal antibody

Ref: AB-PAB28033
OR10J3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OR10J3.
Información adicional
Size 100 uL
Gene Name OR10J3
Gene Alias OR1-25|OR10J3P
Gene Description olfactory receptor, family 10, subfamily J, member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LKPKSQSSLGQDRLISVTYTHHSPTEPCCVQPEEQGGQRCSAQSRGAKNSVSLMKRGCEGFSFAFINMY
Form Liquid
Recomended Dilution Immunohistochemistry (1:500 - 1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OR10J3
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 441911
Iso type IgG

Enviar uma mensagem


OR10J3 polyclonal antibody

OR10J3 polyclonal antibody