CHCHD2 polyclonal antibody
  • CHCHD2 polyclonal antibody

CHCHD2 polyclonal antibody

Ref: AB-PAB28031
CHCHD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHCHD2.
Información adicional
Size 100 uL
Gene Name CHCHD2
Gene Alias C7orf17
Gene Description coiled-coil-helix-coiled-coil-helix domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq YQQHQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50 - 1:200)
Western Blot (1:250 - 1:500)
Immunoflurorescence (1-4 µg/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHCHD2
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 51142
Iso type IgG

Enviar uma mensagem


CHCHD2 polyclonal antibody

CHCHD2 polyclonal antibody