FYB polyclonal antibody
  • FYB polyclonal antibody

FYB polyclonal antibody

Ref: AB-PAB28030
FYB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FYB.
Información adicional
Size 100 uL
Gene Name FYB
Gene Alias ADAP|PRO0823|SLAP-130
Gene Description FYN binding protein (FYB-120/130)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RPFRVTGPNSSSGIQARKNLFNNQGNASPPAGPSNVPKFGSPKPPVAVKPSSEEKPDKEPKPPFLKPTGAGQRFGTPASLTTRDPEAKVGFLKPVGPKPINLPKEDSKPTFPWPPGNKPSLHSVNQD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50 - 1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FYB
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 2533
Iso type IgG

Enviar uma mensagem


FYB polyclonal antibody

FYB polyclonal antibody