VMO1 polyclonal antibody
  • VMO1 polyclonal antibody

VMO1 polyclonal antibody

Ref: AB-PAB28025
VMO1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant VMO1.
Información adicional
Size 100 uL
Gene Name VMO1
Gene Alias ERGA6350|MGC125880|MGC125881|PRO21055
Gene Description vitelline membrane outer layer 1 homolog (chicken)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50 - 1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human VMO1
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 284013
Iso type IgG

Enviar uma mensagem


VMO1 polyclonal antibody

VMO1 polyclonal antibody