NXPH1 polyclonal antibody
  • NXPH1 polyclonal antibody

NXPH1 polyclonal antibody

Ref: AB-PAB28021
NXPH1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NXPH1.
Información adicional
Size 100 uL
Gene Name NXPH1
Gene Alias NPH1|Nbla00697
Gene Description neurexophilin 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGW
Form Liquid
Recomended Dilution Immunohistochemistry (1:500 - 1:1000)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NXPH1
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 30010
Iso type IgG

Enviar uma mensagem


NXPH1 polyclonal antibody

NXPH1 polyclonal antibody