ST3GAL6 polyclonal antibody
  • ST3GAL6 polyclonal antibody

ST3GAL6 polyclonal antibody

Ref: AB-PAB28018
ST3GAL6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ST3GAL6.
Información adicional
Size 100 uL
Gene Name ST3GAL6
Gene Alias SIAT10|ST3GALVI
Gene Description ST3 beta-galactoside alpha-2,3-sialyltransferase 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ST3GAL6
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 10402
Iso type IgG

Enviar uma mensagem


ST3GAL6 polyclonal antibody

ST3GAL6 polyclonal antibody