SGIP1 polyclonal antibody
  • SGIP1 polyclonal antibody

SGIP1 polyclonal antibody

Ref: AB-PAB28015
SGIP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SGIP1.
Información adicional
Size 100 uL
Gene Name SGIP1
Gene Alias DKFZp686A16142|DKFZp761D221|FLJ33378|FLJ43054
Gene Description SH3-domain GRB2-like (endophilin) interacting protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GTPPPLPPKNVPATPPRTGSPLTIGPGNDQSATEVKIEKLPSINDLDSIFGPVLSPKSVAVNAEEKWVHFSDTSPEHVTPELTPREKVVSPPATPDNPADSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10 - 1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SGIP1
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 84251
Iso type IgG

Enviar uma mensagem


SGIP1 polyclonal antibody

SGIP1 polyclonal antibody