PLXDC2 polyclonal antibody
  • PLXDC2 polyclonal antibody

PLXDC2 polyclonal antibody

Ref: AB-PAB28014
PLXDC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLXDC2.
Información adicional
Size 100 uL
Gene Name PLXDC2
Gene Alias FLJ14623|TEM7R
Gene Description plexin domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CLQFNRCGPCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEESKEKMCENTEPVETSSRTTTTVGATTTQFRVLTTTRRAVTSQFPTSLPTEDDTKIALHLKDNGASTDDSAAEKKG
Form Liquid
Recomended Dilution Immunohistochemistry (1:10 - 1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLXDC2
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 84898
Iso type IgG

Enviar uma mensagem


PLXDC2 polyclonal antibody

PLXDC2 polyclonal antibody