ANKRD46 polyclonal antibody
  • ANKRD46 polyclonal antibody

ANKRD46 polyclonal antibody

Ref: AB-PAB28010
ANKRD46 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD46.
Información adicional
Size 100 uL
Gene Name ANKRD46
Gene Alias -
Gene Description ankyrin repeat domain 46
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFNRGTHSKLETMQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20 - 1:50)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD46
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 157567
Iso type IgG

Enviar uma mensagem


ANKRD46 polyclonal antibody

ANKRD46 polyclonal antibody