PDDC1 polyclonal antibody
  • PDDC1 polyclonal antibody

PDDC1 polyclonal antibody

Ref: AB-PAB28008
PDDC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PDDC1.
Información adicional
Size 100 uL
Gene Name PDDC1
Gene Alias FLJ34283|FLJ35497|MGC131881|MGC138350
Gene Description Parkinson disease 7 domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq KPICAVGHGVAALCCATNEDRSWVFDSYSLTGPSVCELVRAPGFARLPLVVEDFVKDSGACFSASEPDAVHVVLDRHLVTGQNASSTVPAVQNLLFLCGSRK
Form Liquid
Recomended Dilution Immunohistochemistry (1:10 - 1:20)
Western Blot (1:100 - 1:250)
Immunoflurorescence (1-4 µg/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PDDC1
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 347862
Iso type IgG

Enviar uma mensagem


PDDC1 polyclonal antibody

PDDC1 polyclonal antibody