PPAN polyclonal antibody
  • PPAN polyclonal antibody

PPAN polyclonal antibody

Ref: AB-PAB28002
PPAN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPAN.
Información adicional
Size 100 uL
Gene Name PPAN
Gene Alias BXDC3|MGC14226|MGC45852|SSF|SSF1|SSF2
Gene Description peter pan homolog (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPAN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 56342
Iso type IgG

Enviar uma mensagem


PPAN polyclonal antibody

PPAN polyclonal antibody