C15orf44 polyclonal antibody
  • C15orf44 polyclonal antibody

C15orf44 polyclonal antibody

Ref: AB-PAB28001
C15orf44 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C15orf44.
Información adicional
Size 100 uL
Gene Name C15orf44
Gene Alias DKFZp564O1664
Gene Description chromosome 15 open reading frame 44
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LTADVQVFPRPEPFVVDEEIDPIPKVINTDLEIVGFIDIADISSPPVLSRHLVLPIALNKEGDEVGTGITDDNEDENSANQIAGKIPNFCVLLHGSLKVEGMVAIVQL
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000 - 1:2500)
Western Blot (1:100 - 1:250)
Immunoflurorescence (1-4 µg/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C15orf44
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 81556
Iso type IgG

Enviar uma mensagem


C15orf44 polyclonal antibody

C15orf44 polyclonal antibody