C3orf33 polyclonal antibody
  • C3orf33 polyclonal antibody

C3orf33 polyclonal antibody

Ref: AB-PAB27996
C3orf33 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C3orf33.
Información adicional
Size 100 uL
Gene Name C3orf33
Gene Alias FLJ31139
Gene Description chromosome 3 open reading frame 33
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq RLTSKFTSSSDIPVEFIRRNVKLRGRLRRITENGLEIEHIPITLPIIASLRKEPRGALLVKLAGVELAETGKAWLQKELKPSQLLWFQL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20 - 1:50)
Western Blot (1:100 - 1:250)
Immunoflurorescence (1-4 µg/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C3orf33
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 285315
Iso type IgG

Enviar uma mensagem


C3orf33 polyclonal antibody

C3orf33 polyclonal antibody