C1orf170 polyclonal antibody
  • C1orf170 polyclonal antibody

C1orf170 polyclonal antibody

Ref: AB-PAB27994
C1orf170 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1orf170.
Información adicional
Size 100 uL
Gene Name C1orf170
Gene Alias MGC13275|RP11-54O7.8
Gene Description chromosome 1 open reading frame 170
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ILKHLPRPPPSAVTRVGPGSSFAVTLPEAYEFFFCDTIEENEEAEAAAAGQDPAGVQWPDMCEFFFPDVGAQRSRRRGSPEPLPRADPVPAPIPGDPVPISIPE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C1orf170
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84808
Iso type IgG

Enviar uma mensagem


C1orf170 polyclonal antibody

C1orf170 polyclonal antibody