WDR65 polyclonal antibody
  • WDR65 polyclonal antibody

WDR65 polyclonal antibody

Ref: AB-PAB27990
WDR65 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WDR65.
Información adicional
Size 100 uL
Gene Name WDR65
Gene Alias FLJ32000|RP11-282K6.2
Gene Description WD repeat domain 65
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PESNLVYWLWEKQKVMAIVRIDTQNNPVYQVSFSPQDNTQVCVTGNGMFKLLRFAEGTLKQTSFQRGEPQNYLAHTWVADDKIVVGTDTGKLFLFESGDQRWETSIMVKEPTNGSKSLDVIQESESLIEFPPVSSPLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50 - 1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WDR65
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 149465
Iso type IgG

Enviar uma mensagem


WDR65 polyclonal antibody

WDR65 polyclonal antibody