APOOL polyclonal antibody
  • APOOL polyclonal antibody

APOOL polyclonal antibody

Ref: AB-PAB27989
APOOL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant APOOL.
Información adicional
Size 100 uL
Gene Name APOOL
Gene Alias CXorf33|FAM121A|MGC129748|UNQ8193
Gene Description apolipoprotein O-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq ATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPED
Form Liquid
Recomended Dilution Immunohistochemistry (1:500 - 1:1000)
Western Blot (1:250 - 1:500)
Immunoflurorescence (1-4 µg/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human APOOL
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 139322
Iso type IgG

Enviar uma mensagem


APOOL polyclonal antibody

APOOL polyclonal antibody