PRNP polyclonal antibody
  • PRNP polyclonal antibody

PRNP polyclonal antibody

Ref: AB-PAB27938
PRNP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRNP.
Información adicional
Size 100 uL
Gene Name PRNP
Gene Alias ASCR|CD230|CJD|GSS|MGC26679|PRIP|PrP|PrP27-30|PrP33-35C|PrPc|prion
Gene Description prion protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRNP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5621
Iso type IgG

Enviar uma mensagem


PRNP polyclonal antibody

PRNP polyclonal antibody