TBL3 polyclonal antibody
  • TBL3 polyclonal antibody

TBL3 polyclonal antibody

Ref: AB-PAB27929
TBL3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TBL3.
Información adicional
Size 100 uL
Gene Name TBL3
Gene Alias SAZD
Gene Description transducin (beta)-like 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq LWKDVTEAEQAEEQARQEEQVVRQQELDNLLHEKRYLRALGLAISLDRPHTVLTVIQAIRRDPEACEKLEATMLRLRRDQKEALLRFCVTWNTNSRHCHEAQAVLGVLL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (0.04-0.4 ug/mL)
Immunofluorescence (0.25-2 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TBL3.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 10607
Iso type IgG

Enviar uma mensagem


TBL3 polyclonal antibody

TBL3 polyclonal antibody