B9D2 polyclonal antibody
  • B9D2 polyclonal antibody

B9D2 polyclonal antibody

Ref: AB-PAB27926
B9D2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant B9D2.
Información adicional
Size 100 uL
Gene Name B9D2
Gene Alias ICIS-1|MGC4093
Gene Description B9 protein domain 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq WSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human B9D2.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 80776
Iso type IgG

Enviar uma mensagem


B9D2 polyclonal antibody

B9D2 polyclonal antibody