TMEM208 polyclonal antibody
  • TMEM208 polyclonal antibody

TMEM208 polyclonal antibody

Ref: AB-PAB27915
TMEM208 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM208.
Información adicional
Size 100 uL
Gene Name TMEM208
Gene Alias HSPC171
Gene Description transmembrane protein 208
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SYHSMSSMARAAFSEDGALMDGGMDLNMEQGMAEHLKDV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM208.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29100
Iso type IgG

Enviar uma mensagem


TMEM208 polyclonal antibody

TMEM208 polyclonal antibody