TTLL9 polyclonal antibody
  • TTLL9 polyclonal antibody

TTLL9 polyclonal antibody

Ref: AB-PAB27909
TTLL9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTLL9.
Información adicional
Size 100 uL
Gene Name TTLL9
Gene Alias C20orf125|MGC120486|MGC120487|dJ310O13.1
Gene Description tubulin tyrosine ligase-like family, member 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq GITWIMKPVARSQGKGIFLFRRLKDIVDWRKDTRSSDDQKDDIPVENYVAQRYIE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TTLL9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 164395
Iso type IgG

Enviar uma mensagem


TTLL9 polyclonal antibody

TTLL9 polyclonal antibody