NRN1L polyclonal antibody
  • NRN1L polyclonal antibody

NRN1L polyclonal antibody

Ref: AB-PAB27907
NRN1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NRN1L.
Información adicional
Size 100 uL
Gene Name NRN1L
Gene Alias MGC118990|MGC118993|UNQ2446
Gene Description neuritin 1-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GELETICRSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NRN1L.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 123904
Iso type IgG

Enviar uma mensagem


NRN1L polyclonal antibody

NRN1L polyclonal antibody