Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
VWA3A polyclonal antibody
Abnova
VWA3A polyclonal antibody
Ref: AB-PAB27906
VWA3A polyclonal antibody
Contacte-nos
Información del producto
Rabbit polyclonal antibody raised against recombinant VWA3A.
Información adicional
Size
100 uL
Gene Name
VWA3A
Gene Alias
FLJ40941|FLJ46765
Gene Description
von Willebrand factor A domain containing 3A
Storage Conditions
Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key
IHC-P
Immunogen Prot. Seq
QGIYLFTGGIPDQDMPTLSAYMAEACGGCDLQLNVCLFYVGEPKMDTTPPARYASHTDTAAAYKEVTRAAGGRFHWFGDTGIYESDDINSIMSEMEKALNYSQKCA
Form
Liquid
Recomended Dilution
Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species
Human
Immunogen
Recombinant protein corresponding to amino acids of human VWA3A.
Storage Buffer
In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID
146177
Iso type
IgG
Enviar uma mensagem
VWA3A polyclonal antibody
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*