C18orf62 polyclonal antibody
  • C18orf62 polyclonal antibody

C18orf62 polyclonal antibody

Ref: AB-PAB27905
C18orf62 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C18orf62.
Información adicional
Size 100 uL
Gene Name C18orf62
Gene Alias MGC126049
Gene Description chromosome 18 open reading frame 62
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RNHSRIQGVSEDWKRANSIFRNFLRLKSSRNTAEAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C18orf62.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 284274
Iso type IgG

Enviar uma mensagem


C18orf62 polyclonal antibody

C18orf62 polyclonal antibody