CHMP4B polyclonal antibody
  • CHMP4B polyclonal antibody

CHMP4B polyclonal antibody

Ref: AB-PAB27902
CHMP4B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHMP4B.
Información adicional
Size 100 uL
Gene Name CHMP4B
Gene Alias C20orf178|CHMP4A|CTPP3|SNF7|SNF7-2|Shax1|dJ553F4.4
Gene Description chromatin modifying protein 4B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHMP4B.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 128866
Iso type IgG

Enviar uma mensagem


CHMP4B polyclonal antibody

CHMP4B polyclonal antibody