NAE1 polyclonal antibody
  • NAE1 polyclonal antibody

NAE1 polyclonal antibody

Ref: AB-PAB27899
NAE1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NAE1.
Información adicional
Size 100 uL
Gene Name NAE1
Gene Alias A-116A10.1|APPBP1|HPP1|ula-1
Gene Description NEDD8 activating enzyme E1 subunit 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NAE1.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 8883
Iso type IgG

Enviar uma mensagem


NAE1 polyclonal antibody

NAE1 polyclonal antibody