TK2 polyclonal antibody
  • TK2 polyclonal antibody

TK2 polyclonal antibody

Ref: AB-PAB27897
TK2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TK2.
Información adicional
Size 100 uL
Gene Name TK2
Gene Alias -
Gene Description thymidine kinase 2, mitochondrial
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq YVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TK2.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 7084
Iso type IgG

Enviar uma mensagem


TK2 polyclonal antibody

TK2 polyclonal antibody