C20orf72 polyclonal antibody
  • C20orf72 polyclonal antibody

C20orf72 polyclonal antibody

Ref: AB-PAB27888
C20orf72 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C20orf72.
Información adicional
Size 100 uL
Gene Name C20orf72
Gene Alias FLJ14597|bA504H3.4
Gene Description chromosome 20 open reading frame 72
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq NLVQSVLSSRGVAQTPGSVEEDALLCGPVSKHKLPNQGEDRRVPQNWFPIFNPERSDKPNASDPSVPLKIPLQRNVIPSVTRVL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C20orf72.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 92667
Iso type IgG

Enviar uma mensagem


C20orf72 polyclonal antibody

C20orf72 polyclonal antibody