CTDSPL2 polyclonal antibody
  • CTDSPL2 polyclonal antibody

CTDSPL2 polyclonal antibody

Ref: AB-PAB27882
CTDSPL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CTDSPL2.
Información adicional
Size 100 uL
Gene Name CTDSPL2
Gene Alias FLJ10523|HSPC058|HSPC129
Gene Description CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq RLRTRKASQQSNQIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTPKEERENPSKRSRIERDIDNNLITSTPRAGEKPNKQISRV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CTDSPL2.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 51496
Iso type IgG

Enviar uma mensagem


CTDSPL2 polyclonal antibody

CTDSPL2 polyclonal antibody