ZNF609 polyclonal antibody
  • ZNF609 polyclonal antibody

ZNF609 polyclonal antibody

Ref: AB-PAB27880
ZNF609 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF609.
Información adicional
Size 100 uL
Gene Name ZNF609
Gene Alias KIAA0295|MGC164858
Gene Description zinc finger protein 609
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq DGEGKVDSVKSKDAEQLVKEGAKKTLFPPQPQSKDSPYYQGFESYYSPSYAQSSPGALNPSSQAGVESQALKTKRDEEPESIEGKVKNDICEEKKPE
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF609.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 23060
Iso type IgG

Enviar uma mensagem


ZNF609 polyclonal antibody

ZNF609 polyclonal antibody