REP15 polyclonal antibody
  • REP15 polyclonal antibody

REP15 polyclonal antibody

Ref: AB-PAB27874
REP15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant REP15.
Información adicional
Size 100 uL
Gene Name REP15
Gene Alias -
Gene Description Rab15 effector protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FDKLEEFCNLIGEDCLGLFIIFGMPGKPKDIRGVVLDSVKSQMVRSHLPGGKAVAQFVLETEDCVFIKELLRNCLSKKDGLREVGKVYISIL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human REP15.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 387849
Iso type IgG

Enviar uma mensagem


REP15 polyclonal antibody

REP15 polyclonal antibody