NOP2 polyclonal antibody
  • NOP2 polyclonal antibody

NOP2 polyclonal antibody

Ref: AB-PAB27870
NOP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NOP2.
Información adicional
Size 100 uL
Gene Name NOP2
Gene Alias MGC117384|MGC149287|MGC149288|NOL1|NOP120|NSUN1|p120
Gene Description NOP2 nucleolar protein homolog (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq KLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGH
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NOP2.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 4839
Iso type IgG

Enviar uma mensagem


NOP2 polyclonal antibody

NOP2 polyclonal antibody