GAPDH polyclonal antibody
  • GAPDH polyclonal antibody

GAPDH polyclonal antibody

Ref: AB-PAB27869
GAPDH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GAPDH.
Información adicional
Size 100 uL
Gene Name GAPDH
Gene Alias G3PD|GAPD|MGC88685
Gene Description glyceraldehyde-3-phosphate dehydrogenase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GAPDH.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 2597
Iso type IgG

Enviar uma mensagem


GAPDH polyclonal antibody

GAPDH polyclonal antibody