GOLGA3 polyclonal antibody
  • GOLGA3 polyclonal antibody

GOLGA3 polyclonal antibody

Ref: AB-PAB27868
GOLGA3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GOLGA3.
Información adicional
Size 100 uL
Gene Name GOLGA3
Gene Alias GCP170|MEA-2
Gene Description golgi autoantigen, golgin subfamily a, 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TTLTSKLKASQAEISSLQSVRQWYQQQLALAQEARVRLQGEMAHIQVGQMTQAGLLEHLKLENVSLSQQLTETQHRSMKEKGRIAAQLQGIEADMLDQEAA
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GOLGA3.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 2802
Iso type IgG

Enviar uma mensagem


GOLGA3 polyclonal antibody

GOLGA3 polyclonal antibody