DQX1 polyclonal antibody
  • DQX1 polyclonal antibody

DQX1 polyclonal antibody

Ref: AB-PAB27859
DQX1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DQX1.
Información adicional
Size 100 uL
Gene Name DQX1
Gene Alias FLJ23757
Gene Description DEAQ box polypeptide 1 (RNA-dependent ATPase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LQGLLQDARLEKLPGDLRVVVVTDPALEPKLRAFWGNPPIVHIPREPGERPSPIYWDTIPPDRVEAACQAVLELCRKELPGDVLVFLPSEEEISLCCE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DQX1.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 165545
Iso type IgG

Enviar uma mensagem


DQX1 polyclonal antibody

DQX1 polyclonal antibody