FAM115C polyclonal antibody
  • FAM115C polyclonal antibody

FAM115C polyclonal antibody

Ref: AB-PAB27856
FAM115C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM115C.
Información adicional
Size 100 uL
Gene Name FAM115C
Gene Alias FAM139A|FLJ40722|MGC142090
Gene Description family with sequence similarity 115, member C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WLARGQTGKVGVNTNLKDLCPLLSEHGLQCSLEPHLNSDLCVYCCKAYSDKEAKQLQEFVAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM115C.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 285966
Iso type IgG

Enviar uma mensagem


FAM115C polyclonal antibody

FAM115C polyclonal antibody