TMEM221 polyclonal antibody
  • TMEM221 polyclonal antibody

TMEM221 polyclonal antibody

Ref: AB-PAB27518
TMEM221 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM221.
Información adicional
Size 100 uL
Gene Name TMEM221
Gene Alias -
Gene Description transmembrane protein 221
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RGLHELSPPSFEDDLARPAEVSKASPRAQPQQGIHRRTPYSTCP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM221.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 100130519
Iso type IgG

Enviar uma mensagem


TMEM221 polyclonal antibody

TMEM221 polyclonal antibody