CCDC61 polyclonal antibody
  • CCDC61 polyclonal antibody

CCDC61 polyclonal antibody

Ref: AB-PAB27507
CCDC61 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC61.
Información adicional
Size 100 uL
Gene Name CCDC61
Gene Alias -
Gene Description coiled-coil domain containing 61
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KTGNFKQFNIFCHMLESALTQSSESVTLDLLTYTDLESLRNRKMGGRPGSLAPRSAQLNSKRYLILIYSVEFDRIHYPLPLPYQGKPDPVVLQGIIRSLK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC61.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 729440
Iso type IgG

Enviar uma mensagem


CCDC61 polyclonal antibody

CCDC61 polyclonal antibody