ZNF260 polyclonal antibody
  • ZNF260 polyclonal antibody

ZNF260 polyclonal antibody

Ref: AB-PAB27493
ZNF260 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF260.
Información adicional
Size 100 uL
Gene Name ZNF260
Gene Alias ZFP260|ozrf1
Gene Description zinc finger protein 260
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MIGMLESLQHESDLLQHDQIHTGEKPYECNECRKTFSLKQNLVEHKKMHTGEKSH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF260.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 339324
Iso type IgG

Enviar uma mensagem


ZNF260 polyclonal antibody

ZNF260 polyclonal antibody