ZMAT1 polyclonal antibody
  • ZMAT1 polyclonal antibody

ZMAT1 polyclonal antibody

Ref: AB-PAB27467
ZMAT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZMAT1.
Información adicional
Size 100 uL
Gene Name ZMAT1
Gene Alias KIAA1789|MGC176597|MGC176728
Gene Description zinc finger, matrin type 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NSRKTQDSYQNECADYINVQKARGLEAKTCFRKMEESSLETRRYREVVDSRPRHRMFEQRLPFETFRTYAAPYNISQAMEKQLPHSKKTYDSFQDELEDYIKVQKARGLDPKTCFRKMRENSVDTHGYREMVDSGP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZMAT1.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 84460
Iso type IgG

Enviar uma mensagem


ZMAT1 polyclonal antibody

ZMAT1 polyclonal antibody