ZNF135 polyclonal antibody
  • ZNF135 polyclonal antibody

ZNF135 polyclonal antibody

Ref: AB-PAB27462
ZNF135 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF135.
Información adicional
Size 100 uL
Gene Name ZNF135
Gene Alias ZNF61|ZNF78L1|pHZ-17|pT3
Gene Description zinc finger protein 135
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq FLWDGLWYCRGEDTEGHWEWSCESLESLAVPVAFTPVKTPVLEQWQRNGFGENISLNPDLPHQPMTPERQSPHTWGTRGKREKPDLNVLQKTCVKEKPYKCQECGKAFSHSSALI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF135.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 7694
Iso type IgG

Enviar uma mensagem


ZNF135 polyclonal antibody

ZNF135 polyclonal antibody